DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxl2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_004917868.1 Gene:foxl2 / 100486124 XenbaseID:XB-GENE-486612 Length:326 Species:Xenopus tropicalis


Alignment Length:155 Identity:54/155 - (34%)
Similarity:78/155 - (50%) Gaps:13/155 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 SAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPV 405
            |:....|:.....|.|...|...:|..|...|.|:.:.:.:|.|.....|       ::..||..
 Frog     3 SSCAPTHYCSPGCYCLNQGSDRMASFQSPEQGTVALMTHNSNGNKEAERS-------KEDLLPEK 60

  Fly   406 G----SPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLN 466
            |    .|..||.|||..|||:|::.|....|.:|.||.::...||::|....||:||:|||||||
 Frog    61 GQEKPDPSQKPPYSYVALIAMAIRESAEKRLTLSAIYQYIISKFPFYEKNKKGWQNSIRHNLSLN 125

  Fly   467 KCFEKIERPATNGNQRKGCRWAMNP 491
            :||.|:  |...|.:|||..|.::|
 Frog   126 ECFIKV--PREGGGERKGNYWTLDP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/81 (47%)
foxl2XP_004917868.1 Forkhead 69..155 CDD:365978 38/82 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.