DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxk2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001135634.1 Gene:foxk2 / 100216193 XenbaseID:XB-GENE-483520 Length:645 Species:Xenopus tropicalis


Alignment Length:242 Identity:67/242 - (27%)
Similarity:102/242 - (42%) Gaps:51/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 KRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSS--SSASSPLGNVSNLVNIANNNTSGAG 389
            |:.|:|..:|........||       .::..|.:::.  |...||.|.:| ..|...::..|||
 Frog   125 KQKLEAPESPVKPVQPQISP-------LTINIPDNMAHLISPLPSPTGTIS-AANSCPSSPRGAG 181

  Fly   390 S-----GLVKP-------LQQKVKLPPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIY 438
            |     |.|.|       .|.:......|...|    ||.|||:.||..|:..:....|.::.||
 Frog   182 SSGFKLGRVIPPDLIAEAAQSENDKDASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIY 246

  Fly   439 SFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQK 503
            :.:.:::||:..|..||:||:|||||||:.|.|:  |.:.....||..|.::|...:|:.|:..:
 Frog   247 THITKNYPYYRTADKGWQNSIRHNLSLNRYFIKV--PRSQEEPGKGSFWRIDPASESKLVEQAFR 309

  Fly   504 WSRK----------DPAAIRGAMVYPQHL-------------ESLER 527
            ..|.          .|.:.|.|...|.|.             |||.|
 Frog   310 KRRPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGLQTPESLSR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 33/87 (38%)
foxk2NP_001135634.1 FHA 10..117 CDD:238017
Forkhead 218..304 CDD:365978 33/87 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.