DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxc1a

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_571803.1 Gene:foxc1a / 100148408 ZFINID:ZDB-GENE-010302-1 Length:476 Species:Danio rerio


Alignment Length:185 Identity:56/185 - (30%)
Similarity:90/185 - (48%) Gaps:37/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 MQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAG---SGLVKPL---------QQKVKL 402
            ||:.||:.||:|         ||.|..:.:..:...:.||   :|:..|:         |....:
Zfish     1 MQARYSVSSPNS---------LGVVPYISSDQSYYRAAAGGGYTGMPAPMTMYSHAAHDQYPASM 56

  Fly   403 -----PPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNS 458
                 |....|.|    ||.|||..||.:|::||....:.::.||.|:.:.||::.:...||:||
Zfish    57 ARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNS 121

  Fly   459 VRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----EEVQKWSRKD 508
            :|||||||:||.|:  |..:....||..|.::||..|..:     ...:::.:||
Zfish   122 IRHNLSLNECFVKV--PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 36/92 (39%)
foxc1aNP_571803.1 Forkhead 74..160 CDD:278670 36/87 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..271 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.