DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxj3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001103516.1 Gene:foxj3 / 100126207 XenbaseID:XB-GENE-481185 Length:603 Species:Xenopus tropicalis


Alignment Length:307 Identity:84/307 - (27%)
Similarity:135/307 - (43%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 SSLSSSSASS---PLGNVSNLVNIANNNTSGAGSGLVKPL----------QQKVKLPPVGSPFPK 411
            |.|.||..|.   |...|...:..::.:....|:|:.|..          |::|:....|    |
 Frog     3 SELESSLTSMDWLPKITVRAAIQSSDCSQHAHGTGIPKKNSVLDPNTTLDQEEVQQHKDG----K 63

  Fly   412 PAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPA 476
            |.|||:.||..|:.:|....:.:||||.::|.:|||::.|.||||||:||||||||||.|:  |.
 Frog    64 PPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKV--PR 126

  Fly   477 TNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDP-AAIRGAMVYPQHLESLERGEMKHGSADSDVE 540
            :..:..||..||::   .|..::..|...||.| :..|.:..|....:||....:..|||..::.
 Frog   127 SKDDPGKGSYWAID---TNPKEDAAQARPRKRPRSEERASTPYSIDSDSLGMDCIIPGSASPNLA 188

  Fly   541 LDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDD--EQIINDFDAEDERHANGNQANNL 603
            :                  :|:.:.:.:...|  :||:|.  ..:.|....:.....|.|...::
 Frog   189 I------------------NTVTNKVTLYNTD--QDGNDSPRSSLNNSLSDQSVSSLNLNNVGSV 233

  Fly   604 -----PINHP-----LLGQKSNDFDIEVGDLYDAIDIEDDKESVRRI 640
                 ..:||     .|.|:|.....|...|:...:.||..:|.|.:
 Frog   234 HSYTSVTSHPEPSAQTLTQQSPYSAPERDKLFPEYNFEDLSDSFRSL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 41/87 (47%)
foxj3NP_001103516.1 FH_FOXJ3 62..140 CDD:410826 41/83 (49%)
COG5025 <63..329 CDD:227358 71/243 (29%)
KLF1_2_4_N <342..419 CDD:425360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.