DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and si:ch211-145o7.3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_001923743.3 Gene:si:ch211-145o7.3 / 100003583 ZFINID:ZDB-GENE-061207-6 Length:332 Species:Danio rerio


Alignment Length:268 Identity:85/268 - (31%)
Similarity:128/268 - (47%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 NSPHHQMQSNY-------SLGSPSSLSSS---SASSPLGNVSNLVNIANNNTSGAGSGL------ 392
            :||.|..::|.       ||..|:||.||   |:|||  .||...:..:.:|:.....|      
Zfish    11 HSPLHFPRNNSEALPLSPSLPQPASLHSSHLHSSSSP--RVSGGSHCLSLSTAPEQDDLTCLNWL 73

  Fly   393 --------VKPLQQKVKLPPVGSPFP---------KPAYSYSCLIALALKNSRAGSLPVSEIYSF 440
                    ::||.:...||.:..|.|         ||.||:|.||.:|:::|...||||..||.:
Zfish    74 HQRGNLLPLQPLPKISTLPQMFDPIPAQHLPSSPAKPPYSFSSLIFMAIEDSPEKSLPVKGIYEW 138

  Fly   441 LCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWS 505
            :.::|||::.||.||:|||||||||:|.|::|.|..:. :..||..|.:.|:....:.|.::| :
Zfish   139 IVENFPYYKEAPGGWRNSVRHNLSLSKSFQRIHRDKSQ-SVGKGSLWRVCPEYRPALLEVLRK-T 201

  Fly   506 RKDPAAIRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAML--V 568
            .......|..:..|..||:.:.|:..........:|||.|.....|...:||....|....|  |
Zfish   202 HYCHRTNRSLLNKPVLLEATDNGQNMFNETMELSDLDSLSSNPPCSFTPDHEELIPMESVGLPEV 266

  Fly   569 EEEDEEED 576
            ..||.|:|
Zfish   267 TGEDTEKD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 39/87 (45%)
si:ch211-145o7.3XP_001923743.3 Forkhead 109..196 CDD:278670 39/87 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.