DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12592 and Tchhl1

DIOPT Version :9

Sequence 1:NP_731474.1 Gene:CG12592 / 41263 FlyBaseID:FBgn0037811 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_082038.2 Gene:Tchhl1 / 71325 MGIID:1918575 Length:638 Species:Mus musculus


Alignment Length:579 Identity:113/579 - (19%)
Similarity:213/579 - (36%) Gaps:138/579 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 SKLSEAAQLLNVSEEKSSISETELERSRQVALNELNKSERFNKTETQLDISVMEVDSSDHDEEEK 200
            |.|:...:|::.||:..::....:..:.|..:......||.        |...|:.||.....|:
Mouse    90 SLLNSEPRLMSKSEKIDAVDLGAIGGNIQQVVGVGPTQERL--------IFPSEMASSGQPSNEE 146

  Fly   201 TEKVGAK---------NNRSLYEIVDSDDEEEQDQDQSDAAK-----PAESENHSEIKKSTSFMD 251
            .| ||.:         ...||...|...::.|..|.:.||.:     ||...:..:.|::|    
Mouse   147 GE-VGDEPMVSPCEDIKTHSLPRNVSEPNDPENQQPKEDAQEVAQNVPATEYDGVQFKRNT---- 206

  Fly   252 QMSGAKGNKSVYEIMDSYETEDPKEAGKNEES---DKDKPAENGKSDK--DKQAETEMSDEDKPS 311
                      |.|:        ||::....:.   ::.||:......|  |...:....||:..|
Mouse   207 ----------VVEV--------PKQSTSPTQEIPRERSKPSRRLSDTKISDHMIQRPTEDEEHTS 253

  Fly   312 EIKSPSTIKKSIISTADEEALLAELASSDLSHLEKMFNPL--------QKSRRQSLHVPSPELAA 368
            ..:.|...|:...:.::...|....|:...|..:::|.|:        |::.:.:..:| ||...
Mouse   254 TTQDPFLQKRDKATGSENTDLSVVAATRKSSQTQEIFEPMDDTKLSEAQETGKDAGRIP-PETNL 317

  Fly   369 KNPKLRRRSERVEVGNDFCPSQSFVDMVAEKKRQKNKRKRLSKSLSGAPEDLEEMEIKHERKRLK 433
            :.||...:                   |||.              .|.|....|...:.:..:.:
Mouse   318 EEPKADAK-------------------VAES--------------HGLPAQEREHNTRDQSVQSR 349

  Fly   434 SSHGASTDSMEED----NENETMTVAEEHHSDGEVSNGEVPIEEKP----TTSSEKPSASELP-- 488
            |.:.:.|.|..|.    .|:|.:|::..  :|.|..:.:  .:|.|    ...::|.||::.|  
Mouse   350 SRNVSETSSRGEQEGEWKEHERITLSPT--ADAETQDEK--CQEFPGSWRENDAKKDSAAKDPSS 410

  Fly   489 EEGNSAPPALKKDVKRLQAARQA-----VSHAVNLLAPPKATEAEPRTLSRKLSPQPPVVDKKSA 548
            ||||...|.:|:|....:.||.:     .:..:|..:|......|.|..|::|:|    ::|:|.
Mouse   411 EEGNQNLPEIKEDSVSGKEARHSEEDTVYAFEINKNSPAAEETLETRERSQELAP----LEKQSQ 471

  Fly   549 KQKKKGKKKQKPQEASPLKSSD----EENHGHRIRTNAGYVTVVDEPPTKVPIIELIKTSSGMVR 609
            ::|.:..:.|.    .|::..|    |::.....:::.|:..:   |.:..|  |:.|:||.:  
Mouse   472 RKKHRATRIQD----KPVRKEDHNEGEDSELSLTQSDEGFCEI---PNSLAP--EVGKSSSEI-- 525

  Fly   610 VEPCTPKQKYFR-ELPPTPKMHGFREEPGPSGMSRKRAKHAAPKVEHNSAKQAALRFKE 667
            .||..|:....: :.....|.......|.|.       |..||.......:...|..:|
Mouse   526 AEPHVPEDSQSQIDHHGDAKQESHTNNPDPQ-------KQGAPGESSREQEAVVLSIQE 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12592NP_731474.1 None
Tchhl1NP_082038.2 S-100 2..86 CDD:238131
EF-hand_7 13..75 CDD:290234
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..638 104/527 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.