DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12592 and qsm

DIOPT Version :9

Sequence 1:NP_731474.1 Gene:CG12592 / 41263 FlyBaseID:FBgn0037811 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:437 Identity:75/437 - (17%)
Similarity:150/437 - (34%) Gaps:116/437 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 SEAAQLLNVSEEKSSI------SETELERSRQVALNELNKSERFNKTETQLD--ISVMEVDSSDH 195
            ::.:..::.||::..:      :|::.:.:.|:.|..| |.....:.:.|:|  ::|..:..||.
  Fly    23 AKGSHKVHCSEDQMRVDIGLPDAESKDQSAPQIYLEGL-KGYPDERCQPQIDGSLAVFRLSLSDF 86

  Fly   196 DEEEKTEKVGAKNNRSLYE---IVDSDDEEEQDQDQS-DAAKPAESENHSEIKKSTSFMDQMSGA 256
            .|...|..|.....:.:|.   |::|...:|....:. ..|.||.:...:....|:|......|.
  Fly    87 YECGVTRMVNQLTGKKVYYHKIIIESTSGKEIVSVKCITTASPAYNVMMNATTGSSSTSTSSGGI 151

  Fly   257 KGNKSVYEIMDSYETEDPKEAGKNEESDKDKPAENGKSDKDKQAETEMSDE----DKPSEIKSPS 317
            .|          ....|...||..|..|.:......|...:.:....:|.:    .:...:||.:
  Fly   152 HG----------LVKRDVLPAGFQEPEDLEITTSLTKRAPEPRLSIGVSQDGQKFTRDLTVKSGT 206

  Fly   318 TIKKSIISTADEEALLAELASSDLSHLEKMFNPLQKSRRQSLHVPSPELAAK----NPKLRRRSE 378
            .:...|  ..||::  |.:....:::|:.          ...|..|..|..|    :|.|.....
  Fly   207 PLTMEI--NLDEDS--APVYGLGVNYLDV----------TDTHTSSETLIFKGCTVDPYLFENFN 257

  Fly   379 RVEVGNDFC---------PSQSFVDMVA----------------------EKKRQ---KNKRKRL 409
            .::  .|..         |..|:|...|                      .:||:   .||...:
  Fly   258 TID--GDILSAKFKAFKFPDSSYVQFRATVNVCLDKCLGTQCSNNQVGFGRRKREISSANKVYEI 320

  Fly   410 SKSLSGAPEDLEEMEIKHERKRLKSSHGASTDSMEEDNENETMTVAEEHHSDGEVSNGEVPIEEK 474
            |.::....:|:|.:                       |:||.:.: ||...:.:::|..:....:
  Fly   321 SLAMFLQVQDIEGV-----------------------NKNEVLQL-EEKLRELKLANQRLARNSR 361

  Fly   475 PTTSSEKPSASELPEEGNSAPPAL---KKDVKRLQAARQAVSHAVNL 518
            ...:.|:..|        ||.||.   ::::..|.|...|.|:.::|
  Fly   362 GNFAMEQTPA--------SAQPAFVVDERELGHLSAGSGAASNGLSL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12592NP_731474.1 None
qsmNP_001286637.1 ZP 30..298 CDD:214579 51/294 (17%)
Zona_pellucida <200..300 CDD:278526 18/115 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.