DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12592 and mey

DIOPT Version :9

Sequence 1:NP_731474.1 Gene:CG12592 / 41263 FlyBaseID:FBgn0037811 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001287622.1 Gene:mey / 43715 FlyBaseID:FBgn0039851 Length:774 Species:Drosophila melanogaster


Alignment Length:542 Identity:112/542 - (20%)
Similarity:182/542 - (33%) Gaps:170/542 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DELSSSLSSSVASKFKEFSKRKRISDSFSDLSEELERIGLRQMRKRIKLEK-SFERTPKKKVQTK 80
            |:|..|||.|....|..::::              ...|:|...|...::: ...|.|::     
  Fly   201 DQLPGSLSRSQYPVFTVYAQK--------------SCFGVRPCSKAWCIDRVQGYRLPER----- 246

  Fly    81 KHLPPVRKKDSVKRRRIII-----------ASPSDEEHDGKVQTND------------------D 116
                 .:...||..||..|           .|.:...|.|..:.:|                  |
  Fly   247 -----AKASQSVATRRDCIELCLGETEFTCRSANYYAHSGLCELSDMDRITLSDEANIAAYDGAD 306

  Fly   117 SSENKTEKPKNQSNCSSNASKLSE----AAQLLNVSEEKSSISETELERSRQVAL---------- 167
            ..||         ||:...|||.|    |.::|...:......:| |:..|.:.|          
  Fly   307 YLEN---------NCAEEPSKLCEFKRVAGRILKTVDSVHQNVQT-LDECRDLCLTAPFRCHSYD 361

  Fly   168 -NELNK-----SERFNKTETQLDISVMEVDSSDHDEEE------------------KTEKV---- 204
             ||..:     |.....|.|.|....:.::.:...|:.                  :|.|:    
  Fly   362 YNETGELVCRLSHHSRATLTDLSEPYLSIEEAATYEQSACYNVSIDCRSGEMITKIRTSKLFDGK 426

  Fly   205 ----GAK-------NNRSLYEIVDSDDEEEQDQDQSDAAKPAES---ENHSEIKKSTSFMDQMSG 255
                ||.       ||...:::....::.|.:..||...:....   ::|..|..|:.....:|.
  Fly   427 VYAKGAPKSCAVNVNNSLEFDLKMRYNDLECNVRQSAYGRYMNDIVIQHHDMIVTSSDLGLAVSC 491

  Fly   256 AKG--NKSVYEIMDSYETEDPKEAGKNEESDKDKP-------AENGKSDKDKQAET--------E 303
            ...  ||:|...:|...|.: .|:..:||...|.|       |.:| ||..:.||.        |
  Fly   492 QYDLTNKTVVNNVDLGVTGE-IESTLSEEIIVDSPNVIMKITARDG-SDMKRIAEVGDPLALRFE 554

  Fly   304 MSDEDKPSEIKSPSTIKKSIISTADEEALLAELASSD---LSHLEKMFN--PLQKSRRQSLHVPS 363
            :.|.:.|.||.....:......:|:...:.|....:|   :|.::|:.|  .:..|:..:...||
  Fly   555 IVDANSPYEIFVRELVAMDGTDSAEITLIDANGCPTDQYIMSAMQKLANNRKVLLSQFDAFKFPS 619

  Fly   364 PEL----AAKNPKLRRRSERVEVGNDFCPSQSFVDMVAEKKRQKN-----KRKRLSKSLSGAPED 419
            .||    |...|.: .|.|.|...||            |....|:     :|||  ..|:|.  |
  Fly   620 SELVQFRALVTPCI-PRCEPVICDND------------ENGELKSLLSYGRRKR--SVLNGT--D 667

  Fly   420 LEEMEIKHERKRLKSSHGASTD 441
            ..|:.||.||::...||.|:.|
  Fly   668 GVELAIKSERQKRDVSHQAAGD 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12592NP_731474.1 None
meyNP_001287622.1 PAN_1 146..223 CDD:278453 7/35 (20%)
PAN_AP_HGF 233..311 CDD:238532 14/96 (15%)
PAN_AP_HGF 319..>380 CDD:238532 11/61 (18%)
ZP 408..642 CDD:214579 50/236 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.