DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12592 and CG17111

DIOPT Version :9

Sequence 1:NP_731474.1 Gene:CG12592 / 41263 FlyBaseID:FBgn0037811 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster


Alignment Length:553 Identity:106/553 - (19%)
Similarity:187/553 - (33%) Gaps:135/553 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ASPSDEEHDGKVQTNDDSSENKT-EKPKNQSNCS----SNASKLSEAAQLLNVSEEKS------- 152
            |:|.|||:          .||:. |:.....|||    :|:|.:...|:.|.:|:::.       
  Fly   243 AAPYDEEY----------MENQCHERAIESDNCSYELYANSSFIYAEARYLGLSQKECQAMCSHE 297

  Fly   153 ----------------SISETELERSRQVALN----ELNKSERFNKTETQLDISVMEVDSSDHDE 197
                            |:||..|.....|:|.    :|.::..:.:....||:.|.      ...
  Fly   298 AKFYCQGVSFYYVNQLSLSECLLHSEDIVSLGPRSLKLRENSVYMRRVKCLDVRVF------CTR 356

  Fly   198 EEKTEKVGAKN--NRSLYEIVDSDDEEEQDQDQSDAAKPAESENHSEIKKSTSFMDQMSGAKGNK 260
            :|.|.|...|:  ...:|..:.|.|...:...........:.  .||:|::..         |..
  Fly   357 DEMTIKYNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQI--GSEVKENRC---------GIL 410

  Fly   261 SVYEIMDSYE----------TEDPKEAGKNEESDKDKPAENGKSDKDKQAETEMSDEDKPSEIKS 315
            ..||:...|:          ..:|     |.::..|:..:.|....:  |.|.:....:.|.:.|
  Fly   411 RAYEMTQEYQRTFISALVVIQNNP-----NVQTQGDRLIKVGCIQSN--ATTSLGVSVRDSSVDS 468

  Fly   316 PSTIKKSIISTADEEALLAELASSDLSHLEKMF---NPLQKSRRQSLHVPSPELAAKNPKLRRRS 377
            ...:..:|       ||     .|.|.:.|.||   ..:..:.....| |.|.::.:...|..:.
  Fly   469 SEPVPSAI-------AL-----ESSLEYTEHMFPHEGVVHYNSSTGPH-PHPSISLQILDLSHQH 520

  Fly   378 ER--VEVGNDFCPSQSFVDMVAEKKRQKNKRKRLSKSLSGAPEDL-EEMEIKHERKRLKSSHGAS 439
            |.  |::|.:.     .:.:|||.                :|:.| |.||:  :...|......|
  Fly   521 ETNDVQIGQNL-----ELQIVAEY----------------SPQQLAEHMEL--QLAPLPDFRATS 562

  Fly   440 TDSMEEDNENETMTVAEEH-HSDGEVSNGEVPIEEKPTTSSEKPSASELPEEGNSAPPALKKDVK 503
            ..:...||||..:.:.|.. .:|..|    .|..|:..|:|.....:.......|....:..|||
  Fly   563 LVAKTADNENFVLLIDERGCPTDASV----FPALERVHTASRSMLRARFHAFKFSGTANVSFDVK 623

  Fly   504 -RLQAARQAVSHAVNLLAPPKATEA-EPRTLSRKLSPQPPVVDKKSAKQKKKGKKKQKPQEASPL 566
             |....|.:.|:.::.....:..:| :|......|..|.||..........:.....:.||..||
  Fly   624 IRFCVERCSPSNCISSSWQRRRRQADQPDRRPEDLRVQNPVYISTVVDVAPQPDNFTRSQEELPL 688

  Fly   567 K------SSDEENHGHRIRTNAGYVTV--VDEP 591
            .      ..|:.|....:....|.:.:  :|:|
  Fly   689 NYNIRVHGPDQSNTNSYLYGERGVLLIAGIDDP 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12592NP_731474.1 None
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 7/21 (33%)
PAN_AP_HGF 270..344 CDD:238532 12/73 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.