DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sle and CG18545

DIOPT Version :10

Sequence 1:NP_731472.1 Gene:sle / 41262 FlyBaseID:FBgn0037810 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_649998.2 Gene:CG18545 / 41264 FlyBaseID:FBgn0037812 Length:199 Species:Drosophila melanogaster


Alignment Length:156 Identity:42/156 - (26%)
Similarity:70/156 - (44%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1040 SQSFVDMVAEKKRQKNKRKRLSKSLSGAPEDLEEMEIKHERKRLKSSHGASTDSMEEDNENETMT 1104
            |.|....||.|.::.:||||:|.|.|...|:||.:.::..|||:|..     .|.|...:.:..|
  Fly    37 SSSLSSSVASKFKEFSKRKRISDSFSDLSEELERIGLRQMRKRIKLE-----KSFERTPKKKVQT 96

  Fly  1105 VAEEHHSDGEVSNGEVPIEEKPTTSSEKPSASELPEEEETVAVEELLMEKPKTCDSPRSEERPTE 1169
              ::|          :|...|..||..:.|.. |.:..:.|.:|:...:..|.  ||:     .:
  Fly    97 --KKH----------LPPVRKKDTSGNRGSFG-LRQMRKRVKLEDTDEKSYKR--SPK-----MK 141

  Fly  1170 IVTSKP---KGMAPVKVEKTAEYYLA 1192
            :::.|.   ||.||:.:.|....|:|
  Fly   142 VISMKQSPLKGPAPIILRKKFGIYVA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sleNP_731472.1 MSCRAMM_ClfA <656..989 CDD:468110
CG18545NP_649998.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.