DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12818 and SPCC5E4.10c

DIOPT Version :9

Sequence 1:NP_649996.1 Gene:CG12818 / 41261 FlyBaseID:FBgn0037809 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_587905.2 Gene:SPCC5E4.10c / 2539376 PomBaseID:SPCC5E4.10c Length:198 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:58/224 - (25%)
Similarity:94/224 - (41%) Gaps:40/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILPKKRWHVRTKENIARVRRDQAAAAAEEKVRQEKLEFAESEARINFLRRQSGLPEKASKESR 65
            :|:|..|.|:|..::||.|||||:..|.......|.|.:..||:.||..||  ..:.|:.|||:.
pombe     3 LNLLKHKSWNVYNEKNIERVRRDEELARLSADKEQAKNDLEESKRRIARLR--GTVYEEDSKETE 65

  Fly    66 EESQCSTETTKGVDLFADYKARVKTTNKDLEKEQKEEQEKYEKQIGYLTYLGQDTNEALKVR--- 127
            .:.:           ||::.|           ||:|::.|.:|....    .:...|.:|.|   
pombe    66 PKVE-----------FANFWA-----------EQEEKERKRQKVYSE----NRHDLEIMKERHGL 104

  Fly   128 ---SWYELAPKRPEVG-DPTATETHHKQKLAH-DPLTLINALLPPEK-KDPKKATKRIRERTPAP 186
               .||   .|..::. |.|:.....|.:... ||:.|:..||...| |:|:...:|...:..:.
pombe   105 GPLPWY---MKTDKISIDETSNNMSSKYRAPQDDPMFLVEKLLSNRKTKNPESDRRRQSRKKKST 166

  Fly   187 SQEPSIPHKDKKSKKDKKKHKSKNGSRET 215
            ..:.|...|.::....|..|.|:..|..|
pombe   167 QIQASDEMKHRRHHVHKVHHYSQKQSSST 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12818NP_649996.1 Cir_N 8..44 CDD:198151 13/35 (37%)
SPCC5E4.10cNP_587905.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106592
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.