DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and birc5l

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_001037948.1 Gene:birc5l / 733575 XenbaseID:XB-GENE-966741 Length:139 Species:Xenopus tropicalis


Alignment Length:72 Identity:30/72 - (41%)
Similarity:40/72 - (55%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 AVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERH 313
            |.|..||..||..:.....|::||:|||.|.||.:..|...||.|...|..|:..|:|..||::|
 Frog    11 ATRLSTFANWPFTEDCACTPERMAEAGFVHCPSDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKH 75

  Fly   314 SPLCPFV 320
            ||.|.|:
 Frog    76 SPSCLFI 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047 29/70 (41%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
birc5lNP_001037948.1 BIR 13..82 CDD:306999 28/68 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.