DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and UBE2L3

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_001243284.1 Gene:UBE2L3 / 7332 HGNCID:12488 Length:212 Species:Homo sapiens


Alignment Length:120 Identity:33/120 - (27%)
Similarity:54/120 - (45%) Gaps:23/120 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  4675 PADTPYANGCFEFDVFFPPDYPNQPMLINLETTGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEK 4739
            |.:.||..|.|..::.||.:||.:|..|..:|...|     ||:...|:|||.|::.      |.
Human    99 PDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYH-----PNIDEKGQVCLPVISA------EN 152

  Fly  4740 WNAQTSSFLQVLVSIQSLILVPEPYFNEPGFERSRGSPSGTNSSREYNSNIYQAC 4794
            |...|.:. ||:.|:.:|:..|:|           ..|...:.:.||:.:..:.|
Human   153 WKPATKTD-QVIQSLIALVNDPQP-----------EHPLRADLAEEYSKDRKKFC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603 32/114 (28%)
UBE2L3NP_001243284.1 COG5078 67..208 CDD:227410 33/120 (28%)
UBCc 67..207 CDD:214562 33/120 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.