DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and UBE2Z

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_075567.2 Gene:UBE2Z / 65264 HGNCID:25847 Length:354 Species:Homo sapiens


Alignment Length:199 Identity:80/199 - (40%)
Similarity:109/199 - (54%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  4626 GDRYHPSRVKRLAQEAVTLSTSLPLSFSSSVFVRCDTDRLDIMKV--LITGPADTPYANGCFEFD 4688
            |:|..|..:.|:.::.:::....|    ..:||..||  :|:.|:  |||||.||||..|.|.|.
Human    93 GERTAPQCLLRIKRDIMSIYKEPP----PGMFVVPDT--VDMTKIHALITGPFDTPYEGGFFLFV 151

  Fly  4689 VFFPPDYPNQPMLINLETTGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEKWN-AQTSSFLQVLV 4752
            ...|||||..|..:.|.|||.::||||||.|.:||||||:|.||.|   ..|: ||:.|  .||:
Human   152 FRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTG---PAWSPAQSIS--SVLI 211

  Fly  4753 SIQSLILVPEPYFNEPGFERSRGSPSGTNSSREYNSNIYQACVRWAMLEQIRSPSQC---FKDVI 4814
            ||||| :...||.||||||:.|    ....|:.||..|....:|.|:.:.:.....|   .:.|:
Human   212 SIQSL-MTENPYHNEPGFEQER----HPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVM 271

  Fly  4815 HKHF 4818
            .|.|
Human   272 EKSF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603 70/156 (45%)
UBE2ZNP_075567.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
UBCc 103..221 CDD:238117 58/129 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0895
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.