Sequence 1: | NP_001262460.1 | Gene: | Bruce / 41260 | FlyBaseID: | FBgn0266717 | Length: | 4976 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_075567.2 | Gene: | UBE2Z / 65264 | HGNCID: | 25847 | Length: | 354 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 80/199 - (40%) |
---|---|---|---|
Similarity: | 109/199 - (54%) | Gaps: | 22/199 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 4626 GDRYHPSRVKRLAQEAVTLSTSLPLSFSSSVFVRCDTDRLDIMKV--LITGPADTPYANGCFEFD 4688
Fly 4689 VFFPPDYPNQPMLINLETTGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEKWN-AQTSSFLQVLV 4752
Fly 4753 SIQSLILVPEPYFNEPGFERSRGSPSGTNSSREYNSNIYQACVRWAMLEQIRSPSQC---FKDVI 4814
Fly 4815 HKHF 4818 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bruce | NP_001262460.1 | BIR | 251..321 | CDD:279047 | |
DUF3643 | 3539..3664 | CDD:289152 | |||
UQ_con | 4636..4790 | CDD:278603 | 70/156 (45%) | ||
UBE2Z | NP_075567.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
UBCc | 103..221 | CDD:238117 | 58/129 (45%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 332..354 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0895 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1404665at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |