DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Bruce and Birc5

DIOPT Version :9

Sequence 1:	NP_001262460.1	Gene:	Bruce / 41260	FlyBaseID:	FBgn0266717	Length:	4976	Species:	Drosophila melanogaster
Sequence 2:	XP_038942711.1	Gene:	Birc5 / 64041	RGDID:	70499	Length:	146	Species:	Rattus norvegicus

Alignment Length:	56	Identity:	23/56 - (41%)
Similarity:	31/56 - (55%)	Gaps:	0/56 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   251 RRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEP 306
            |..||:.||.::.....|::||:|||.|.|:.:..|.|.||.|...|..||..|.|
  Rat    18 RISTFKNWPFLEDCSCTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNP 73

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Bruce	NP_001262460.1	BIR	251..321	CDD:279047	23/56 (41%)
		DUF3643	3539..3664	CDD:289152
		UQ_con	4636..4790	CDD:278603
Birc5	XP_038942711.1	BIR	18..76	CDD:395528	23/56 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1101
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1404665at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	4	3.820