DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and ube2z

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_001007969.2 Gene:ube2z / 493338 XenbaseID:XB-GENE-990986 Length:313 Species:Xenopus tropicalis


Alignment Length:242 Identity:88/242 - (36%)
Similarity:122/242 - (50%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  4634 VKRLAQEAVTLSTSLPLSFSSSVFVRCDTDRLDIMKVLITGPADTPYANGCFEFDVFFPPDYPNQ 4698
            |.|:.::.:::....|    ..:||..|...:..:..|||||.||||..|.|.|....|||||..
 Frog    60 VLRIKRDIMSIYKEPP----PGMFVVPDPHDMTKIHALITGPFDTPYEGGFFLFLFRCPPDYPIH 120

  Fly  4699 PMLINLETTGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEKWN-AQTSSFLQVLVSIQSLILVPE 4762
            |..:.|.|||.::||||||.|.:||||||:|.||.|   ..|: ||:.|  .||:||||| :...
 Frog   121 PPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTG---PAWSPAQSLS--SVLISIQSL-MTEN 179

  Fly  4763 PYFNEPGFERSRGSPSGTNSSREYNSNIYQACVRWAMLEQIRSPSQC---FKDVIHKHF---WLK 4821
            ||.||||||:.|.|    ..|:.||..|....:|.|:.|.:....||   .:.|:.|.|   :..
 Frog   180 PYHNEPGFEQERHS----GDSKNYNECIRHETIRVAVCEMLEGKCQCPDALRSVMEKSFMEYYDF 240

  Fly  4822 REEICA---QIEG------WIEELGKPQYTERASRTISFNSMVLRRH 4859
            .|.:|.   .::|      :.|:.|...|....||..:.:..|..:|
 Frog   241 YEAVCKDRFHLQGQNMQDPFGEKRGHFDYQSLLSRLQTIHQRVREKH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603 68/154 (44%)
ube2zNP_001007969.2 UBCc 62..207 CDD:238117 69/158 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..313 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.