DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and XIAP

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_001158.2 Gene:XIAP / 331 HGNCID:592 Length:497 Species:Homo sapiens


Alignment Length:172 Identity:51/172 - (29%)
Similarity:66/172 - (38%) Gaps:46/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSE 309
            |:||..|.::|:.||  ||....|.::|.||.|:  :..| |:..||.|...|..||..|..|||
Human   160 MYSEEARLKSFQNWP--DYAHLTPRELASAGLYY--TGIG-DQVQCFCCGGKLKNWEPCDRAWSE 219

  Fly   310 HERHSPLCPFVKG------------EYTQNVPLSITYATNPAL--------------------PA 342
            |.||.|.|.||.|            ...:|.|.|.....||::                    ..
Human   220 HRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQL 284

  Fly   343 PGLGFDIISNSDYANVLCTSCSQTGELSVWS-----IERHLK 379
            ...||..:...|  .|.|..|.  |.|:.|.     .|:|.|
Human   285 ARAGFYALGEGD--KVKCFHCG--GGLTDWKPSEDPWEQHAK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047 29/69 (42%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
XIAPNP_001158.2 BIR 1 26..93
BIR 28..95 CDD:237989
Interaction with caspase-7 141..149
BIR 162..232 CDD:197595 32/74 (43%)
BIR 2 163..230 29/71 (41%)
BIR 265..331 CDD:197595 12/62 (19%)
BIR 3 265..330 12/62 (19%)
UBA_BIRC4_8 370..419 CDD:270578
RING-HC_BIRC4_8 436..497 CDD:319628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.