DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and Birc7

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_001156719.1 Gene:Birc7 / 329581 MGIID:2676458 Length:285 Species:Mus musculus


Alignment Length:119 Identity:40/119 - (33%)
Similarity:54/119 - (45%) Gaps:25/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSE 309
            |.||.:|..:|..||  ......|:.:|.|||:|   :..:|:..||.|...|..||:.|:||:|
Mouse    90 MDSEDLRLASFYDWP--STAGIQPEPLAAAGFFH---TGQQDKVRCFFCYGGLQSWERGDDPWTE 149

  Fly   310 HERHSPLCPFV---KGE--------YT--------QNVPLSITYATNPALPAPG 344
            |.|..|.|.|:   ||.        ||        :..|.....|| |:.||.|
Mouse   150 HARWFPRCQFLLRSKGRDFVERIQTYTPLLGSWDQREEPEDAVSAT-PSAPAHG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047 26/72 (36%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Birc7NP_001156719.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..47
BIR 94..161 CDD:237989 26/71 (37%)
BIR 96..161 26/69 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..225 7/20 (35%)
zf-C3HC4_3 235..279 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.