DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and Ube2z

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_001032732.2 Gene:Ube2z / 303478 RGDID:1308347 Length:356 Species:Rattus norvegicus


Alignment Length:199 Identity:80/199 - (40%)
Similarity:109/199 - (54%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  4626 GDRYHPSRVKRLAQEAVTLSTSLPLSFSSSVFVRCDTDRLDIMKV--LITGPADTPYANGCFEFD 4688
            |:|..|..:.|:.::.:::....|    ..:||..||  :|:.|:  |||||.||||..|.|.|.
  Rat    95 GERTAPQCLLRIKRDIMSIYKEPP----PGMFVVPDT--VDMTKIHALITGPFDTPYEGGFFLFV 153

  Fly  4689 VFFPPDYPNQPMLINLETTGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEKWN-AQTSSFLQVLV 4752
            ...|||||..|..:.|.|||.::||||||.|.:||||||:|.||.|   ..|: ||:.|  .||:
  Rat   154 FRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTG---PAWSPAQSIS--SVLI 213

  Fly  4753 SIQSLILVPEPYFNEPGFERSRGSPSGTNSSREYNSNIYQACVRWAMLEQIRSPSQC---FKDVI 4814
            ||||| :...||.||||||:.|    ....|:.||..|....:|.|:.:.:.....|   .:.|:
  Rat   214 SIQSL-MTENPYHNEPGFEQER----HPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVM 273

  Fly  4815 HKHF 4818
            .|.|
  Rat   274 EKSF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603 70/156 (45%)
Ube2zNP_001032732.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
UBCc 105..223 CDD:238117 58/129 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0895
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.