DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and birc5b

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_660196.1 Gene:birc5b / 246726 ZFINID:ZDB-GENE-030826-2 Length:128 Species:Danio rerio


Alignment Length:90 Identity:38/90 - (42%)
Similarity:48/90 - (53%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSE 309
            |:|...|.|||.:||..:.....|:.||:|||.|.||.:..|.|.||.|...|..||..|.||||
Zfish     1 MYSYEKRLQTFSEWPFREDCQCTPELMAKAGFVHCPSENEPDVACCFYCLRELEGWEPDDNPWSE 65

  Fly   310 HERHSPLCPFVKGEYTQNVPLSITY 334
            |.:.||.|.|:....|.:...:|.|
Zfish    66 HAKRSPNCAFLHMSKTFDELTAIEY 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047 33/69 (48%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
birc5bNP_660196.1 BIR 7..77 CDD:279047 33/69 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.