Sequence 1: | NP_001262460.1 | Gene: | Bruce / 41260 | FlyBaseID: | FBgn0266717 | Length: | 4976 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505949.1 | Gene: | bir-1 / 179597 | WormBaseID: | WBGene00000249 | Length: | 155 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 43/203 - (21%) |
---|---|---|---|
Similarity: | 71/203 - (34%) | Gaps: | 60/203 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 219 ERLTDMMMGSRVPDFGWNFSNFQRVLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSS 283
Fly 284 GEDRAMCFTCSVC--LVCWEKTDEPWSEHERHSPLCPFVKGEYTQNVPLSITYATNPALPAPGLG 346
Fly 347 FDIISNSDYANVLCTSCSQTGELSVWSIERHLKLMHTFHVPTLLNYIFEESFEWARVTAICVLPN 411
Fly 412 ARARTKVN 419 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Bruce | NP_001262460.1 | BIR | 251..321 | CDD:279047 | 20/71 (28%) |
DUF3643 | 3539..3664 | CDD:289152 | |||
UQ_con | 4636..4790 | CDD:278603 | |||
bir-1 | NP_505949.1 | BIR | 16..88 | CDD:197595 | 25/94 (27%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 55 | 1.000 | Domainoid score | I7415 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1404665at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |