DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and bir-1

DIOPT Version :10

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_505949.1 Gene:bir-1 / 179597 WormBaseID:WBGene00000249 Length:155 Species:Caenorhabditis elegans


Alignment Length:203 Identity:43/203 - (21%)
Similarity:71/203 - (34%) Gaps:60/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 ERLTDMMMGSRVPDFGWNFSNFQRVLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSS 283
            ::.:||...:...|....|.||:             :::.|  |.| .....:||||||.....|
 Worm     6 KKKSDMAKFTFYKDRLMTFKNFE-------------YDRDP--DAK-CTSQAVAQAGFYCTGPQS 54

  Fly   284 GEDRAMCFTCSVC--LVCWEKTDEPWSEHERHSPLCPFVKGEYTQNVPLSITYATNPALPAPGLG 346
            |:       |:.|  .:.::..|:||.||.:....|.||:.....:..|:|.             
 Worm    55 GK-------CAFCNKELDFDPEDDPWYEHTKRDEPCEFVRIGKLDDSELTIN------------- 99

  Fly   347 FDIISNSDYANVLCTSCSQTGELSVWSIERHLKLMHTFHVPTLLNYIFEESFEWARVTAICVLPN 411
             |.:..|..|.::                  .||   |....::|.:...|...|....:..:||
 Worm   100 -DTVRLSQTAMIM------------------TKL---FEHEMMINNLSNHSSSDALFDQLKKVPN 142

  Fly   412 ARARTKVN 419
            ..:.||.|
 Worm   143 TASTTKSN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:459891 20/71 (28%)
BIRC6 3539..3664 CDD:463547
UBCc_BIRC6 4631..4835 CDD:467430
bir-1NP_505949.1 BIR 16..88 CDD:197595 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.