DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and bir-1

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_505949.1 Gene:bir-1 / 179597 WormBaseID:WBGene00000249 Length:155 Species:Caenorhabditis elegans


Alignment Length:203 Identity:43/203 - (21%)
Similarity:71/203 - (34%) Gaps:60/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 ERLTDMMMGSRVPDFGWNFSNFQRVLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSS 283
            ::.:||...:...|....|.||:             :::.|  |.| .....:||||||.....|
 Worm     6 KKKSDMAKFTFYKDRLMTFKNFE-------------YDRDP--DAK-CTSQAVAQAGFYCTGPQS 54

  Fly   284 GEDRAMCFTCSVC--LVCWEKTDEPWSEHERHSPLCPFVKGEYTQNVPLSITYATNPALPAPGLG 346
            |:       |:.|  .:.::..|:||.||.:....|.||:.....:..|:|.             
 Worm    55 GK-------CAFCNKELDFDPEDDPWYEHTKRDEPCEFVRIGKLDDSELTIN------------- 99

  Fly   347 FDIISNSDYANVLCTSCSQTGELSVWSIERHLKLMHTFHVPTLLNYIFEESFEWARVTAICVLPN 411
             |.:..|..|.::                  .||   |....::|.:...|...|....:..:||
 Worm   100 -DTVRLSQTAMIM------------------TKL---FEHEMMINNLSNHSSSDALFDQLKKVPN 142

  Fly   412 ARARTKVN 419
            ..:.||.|
 Worm   143 TASTTKSN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047 20/71 (28%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
bir-1NP_505949.1 BIR 16..88 CDD:197595 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I7415
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.