DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and Det

DIOPT Version :10

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:XP_061514139.1 Gene:Det / 1277557 VectorBaseID:AGAMI1_000451 Length:141 Species:Anopheles gambiae


Alignment Length:71 Identity:33/71 - (46%)
Similarity:45/71 - (63%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 RRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSP 315
            |.::|:.||..|.|.....:||:||||...:.:..|.|.||.|...|..||::|:|||||.:|:|
Mosquito    17 REKSFKHWPFSDDKQCSIQKMAEAGFYWHGTETEIDIAACFVCGKELDGWEESDDPWSEHRKHAP 81

  Fly   316 LCPFVK 321
            .|||||
Mosquito    82 QCPFVK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:459891 31/69 (45%)
BIRC6 3539..3664 CDD:463547
UBCc_BIRC6 4631..4835 CDD:467430
DetXP_061514139.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.