DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and Xiap

DIOPT Version :10

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:XP_011249278.1 Gene:Xiap / 11798 MGIID:107572 Length:548 Species:Mus musculus


Alignment Length:171 Identity:51/171 - (29%)
Similarity:65/171 - (38%) Gaps:45/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSE 309
            |.||..|.::|:.||  ||....|.::|.||.|:   :..:|:..||.|...|..||..|..|||
Mouse   212 MCSEEARLKSFQNWP--DYAHLTPRELASAGLYY---TGADDQVQCFCCGGKLKNWEPCDRAWSE 271

  Fly   310 HERHSPLCPFVKGEYT-----------QNVPLSITYATNPAL--------------------PAP 343
            |.||.|.|.||.|...           :|.|.|.....|||:                    ...
Mouse   272 HRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKEQLA 336

  Fly   344 GLGFDIISNSDYANVLCTSCSQTGELSVWS-----IERHLK 379
            ..||..:...|  .|.|..|.  |.|:.|.     .|:|.|
Mouse   337 RAGFYALGEGD--KVKCFHCG--GGLTDWKPSEDPWEQHAK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:459891 28/69 (41%)
BIRC6 3539..3664 CDD:463547
UBCc_BIRC6 4631..4835 CDD:467430
XiapXP_011249278.1 BIR 80..147 CDD:237989
BIR 214..284 CDD:197595 31/74 (42%)
BIR 316..382 CDD:197595 12/62 (19%)
UBA_BIRC4_8 421..470 CDD:270578
RING-HC_BIRC4_8 485..548 CDD:438374
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.