DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bruce and AT1G53023

DIOPT Version :9

Sequence 1:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster
Sequence 2:NP_001185206.1 Gene:AT1G53023 / 10723074 AraportID:AT1G53023 Length:316 Species:Arabidopsis thaliana


Alignment Length:293 Identity:94/293 - (32%)
Similarity:155/293 - (52%) Gaps:55/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  4581 KSIEQRYLELMKKRQFDTFDMIVE-SDNNSFRFVVSHHF------EKM----VRLAGDRYHPSR- 4633
            :.:::.:|     |.|..||.:.: ||         ||:      .|:    ::..|   .|.. 
plant    11 RKLKEEFL-----RDFKRFDTVEDFSD---------HHYAAEGSPAKLSLWHLKFKG---RPKNW 58

  Fly  4634 VKRLAQEAVTLSTSLPLSFSSSVFVRCDTDRLDIMKVLITGPADTPYANGCFEFDVFFPPDYPNQ 4698
            ||.:.:|...|..:||    .::|||....|:|:::.:|.|...|||.:|.|.||:.||..||:.
plant    59 VKDIQKEWKILDKNLP----ETIFVRACESRIDLLRAVIIGAEGTPYHDGLFFFDIQFPDTYPSV 119

  Fly  4699 PMLINLETTGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEKWNAQTSSFLQVLVSIQSLILVPEP 4763
            |..::..:.|   :|.|||||..||||||:::||.|:..|||..:.|:.||:|||||:|||..:|
plant   120 PPKVHYHSGG---LRINPNLYKCGKVCLSLISTWTGKKREKWLPKESTMLQLLVSIQALILNEKP 181

  Fly  4764 YFNEPGFERSRGSPSGTNSSREYNSNIYQACVRWAMLEQIRSPSQCFKDVIHKHFWLKREEI--- 4825
            |:||||:|:|.|:|.|.:.|::|:.|::...::          :..|::.:..||:::..:|   
plant   182 YYNEPGYEKSMGTPLGESYSKDYSENVFVFSLK----------TMHFEEFVRSHFFVRSHDIVKA 236

  Fly  4826 CAQIE-----GWIEELG-KPQYTERASRTISFN 4852
            |...:     |.|::.| |.|..:|.|.....|
plant   237 CNAYKDGAPVGSIDKGGVKKQTRQRGSLKFRIN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BruceNP_001262460.1 BIR 251..321 CDD:279047
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603 66/153 (43%)
AT1G53023NP_001185206.1 UBCc 59..186 CDD:238117 58/133 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0895
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.