DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nuak1 and SKS1

DIOPT Version :9

Sequence 1:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster
Sequence 2:NP_015299.1 Gene:SKS1 / 856081 SGDID:S000005947 Length:502 Species:Saccharomyces cerevisiae


Alignment Length:271 Identity:68/271 - (25%)
Similarity:105/271 - (38%) Gaps:83/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCK------------------------- 105
            |...|.|..::|.|.||.|...::..|.:|.|:||:.|..                         
Yeast     6 LLNNFRITAQIGSGAYGLVFHVVDILTSREYAVKTVFKSSSMDEFYNKNGLNNNSQVARTTLLQT 70

  Fly   106 --------------------------IEAEADLVRIRREVQIMSSVH-HPNIIHIYEVFENREKM 143
                                      .|.|.:.:...||:.....|. |.||:.|::|.|:....
Yeast    71 QLYHFFKSFQKKLFLPSVDLDSILQLTENELNRLPHYREIAFQLRVQSHGNIVKIHQVLESSIAT 135

  Fly   144 VLVMEFAAGGELYDYLSERKVLTEEE-------ARRIFRQVATAVYYCHKHKICHRDLKLENILL 201
            .:||::      ||......::.::.       .:::|.|:.:|:.:||:..|.|.|:|.||:||
Yeast   136 FIVMDY------YDRDLFTSIVDDKHFVNHGILIKKVFLQLCSALDHCHRLGIYHCDIKPENVLL 194

  Fly   202 DEKGNAKIADFGLSNVFDDQRLLGTFC-GSPLYASPEIV---EGTPYQGPEVD--C--------- 251
            |...||.:.|||||.  ..:.|....| ||..|.:||.:   ..|...|..||  |         
Yeast   195 DRNDNAYLCDFGLST--KSKYLAPNVCVGSSYYMAPERILYCLNTTTNGIHVDECCSSLPTDTGD 257

  Fly   252 -WSLGVLLYTL 261
             ||||::|..|
Yeast   258 IWSLGIILINL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 67/269 (25%)
SKS1NP_015299.1 PKc_like 9..331 CDD:419665 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.