DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nuak1 and NPR1

DIOPT Version :9

Sequence 1:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster
Sequence 2:NP_014216.1 Gene:NPR1 / 855538 SGDID:S000005127 Length:790 Species:Saccharomyces cerevisiae


Alignment Length:408 Identity:96/408 - (23%)
Similarity:157/408 - (38%) Gaps:105/408 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKPDGTAPNGAAGGAEAAAP-----------------TGLDATGNSL-AHP---SGIPQDQIDNI 47
            |..:...|||:...:..|.|                 |..:..|::: :|.   ||||      .
Yeast   375 SNSNNVIPNGSPLSSGIAVPSHSHSSSHFAAGNNSYSTSYNGNGDTIYSHSHGGSGIP------F 433

  Fly    48 MSGIANTGNVKMNNHRKKLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIK-KCKIEAEAD 111
            ......||                  ..||.|..|.|:|.......:..|:|..: |.:.|::.|
Yeast   434 SKRYIKTG------------------ADLGAGAGGSVKLAQRISDNKIFAVKEFRTKFENESKRD 480

  Fly   112 LV-RIRREVQIMSSVHHPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFR 175
            .| :|..|..|.::::|||||...|:....::::.|||:.. .:|:..:...| ::.||....|:
Yeast   481 YVKKITSEYCIGTTLNHPNIIETIEIVYENDRILQVMEYCE-YDLFAIVMSNK-MSYEEICCCFK 543

  Fly   176 QVATAVYYCHKHKICHRDLKLENILLDEKGNAKIADFGLSNVFD---DQRLL--GTFCGSPLYAS 235
            |:.|.|.|.|...:.||||||:|.:::|||..|:.|||.:.||.   .:.|:  ....||..|.:
Yeast   544 QILTGVQYLHSIGLAHRDLKLDNCVINEKGIVKLIDFGAAVVFSYPFSKNLVEASGIVGSDPYLA 608

  Fly   236 PEIVEGTPYQGPEVDCWSLGVLLYTLVYGSMPF-----------------DGSNFKRLVKQISQG 283
            ||:.....|....||.||..::...::....|:                 |..:...||.:....
Yeast   609 PEVCIFAKYDPRPVDIWSSAIIFACMILKKFPWKIPKLRDNSFKLFCSGRDCDSLSSLVTRTPDP 673

  Fly   284 DYY------EPRKPSRASTLIRD-------------------------MLTVCPRKRASIEQICS 317
            ..|      |.:||..:|..:.|                         |:.:.|..|.:||:|..
Yeast   674 PSYDESHSTEKKKPESSSNNVSDPNNVNIGPQRLLHSLPEETQHIVGRMIDLAPACRGNIEEIME 738

  Fly   318 HWWVNENDNVSCLDLAED 335
            ..|:.   ::....|.||
Yeast   739 DPWIR---SIDMCHLVED 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 77/307 (25%)
NPR1NP_014216.1 PKc_like 451..742 CDD:419665 73/292 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.