DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nuak1 and tssk6

DIOPT Version :9

Sequence 1:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster
Sequence 2:NP_001038310.1 Gene:tssk6 / 557915 ZFINID:ZDB-GENE-060216-3 Length:268 Species:Danio rerio


Alignment Length:286 Identity:94/286 - (32%)
Similarity:154/286 - (53%) Gaps:30/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IDNIMSGIANTGNVKMNNHRKKLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEA 108
            |:|::.|:..|                 .:..:|:|::.:|:|..:::...:||||.:.  ::..
Zfish     3 INNVLKGMGYT-----------------FLTSIGEGSFSRVKLATSQKHCCKVAIKIVD--RMRG 48

  Fly   109 EADLVR--IRREVQIMSSVHHPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEAR 171
            .||.::  :.||:.::..|:|.|||.::|..|...|.:.::..||..:|...:.|...:.::.::
Zfish    49 SADFIQKFLPRELAVLRRVNHENIIQMFECIEVAGKRLCIVMEAAEKDLLQKIHEVHHIPKDLSK 113

  Fly   172 RIFRQVATAVYYCHKHKICHRDLKLENILLDEKGNAKIADFGLSN-VFDDQRLLGTFCGSPLYAS 235
            .:|.|:.:|:.|.|:..|.|||||.|||||......||||||.:. |.|...|..|||||..|..
Zfish   114 TMFAQMVSAINYLHQMNIVHRDLKCENILLTADEKIKIADFGFARFVEDPSELSHTFCGSRAYTP 178

  Fly   236 PEIVEGTPYQGPEVDCWSLGVLLYTLVYGSMPFDGSNFKRLVKQISQGDYYEP-----RKPSRAS 295
            ||::.||||...:.|.|||||:||.:|.|:||:|.:|.:|| :.:.|.....|     .:|.|  
Zfish   179 PEVITGTPYDPKKYDVWSLGVILYVMVTGTMPYDETNVRRL-RLLQQRPLNYPSNVAVEEPCR-- 240

  Fly   296 TLIRDMLTVCPRKRASIEQICSHWWV 321
            ..||.:|...|..|.:|:|:..|.|:
Zfish   241 VFIRTLLQTNPSTRPTIQQVAGHSWL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 89/260 (34%)
tssk6NP_001038310.1 STKc_TSSK6-like 11..266 CDD:271066 90/276 (33%)
S_TKc 12..266 CDD:214567 90/275 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.