DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nuak1 and CG14305

DIOPT Version :9

Sequence 1:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster
Sequence 2:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster


Alignment Length:312 Identity:98/312 - (31%)
Similarity:158/312 - (50%) Gaps:30/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NIMSGIANTGNVKMNNHRKKLRQR-FDIIKKLGQGTYGKV-QLGINKETGQEV--AIKTIKKCKI 106
            |..:||...|.  .::....|.|| :::..|:|:|:|..| ..|...:.|..|  |.|.|.|.| 
  Fly     5 NSSAGIRQLGT--RSSDVDALAQRGYNVGHKIGEGSYATVITAGYADDHGHGVHLACKIIDKAK- 66

  Fly   107 EAEADLVR--IRREVQIMSSVHHPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEE 169
             |..|.|.  ..||::|::.:.|.|||.|:.:.:...|:.:.|.:|..|:|..::.....:.|::
  Fly    67 -APTDFVNKFFPRELEILTKIDHSNIIQIHSILQRGPKIFIFMRYAENGDLLSHIKRSGPIDEKQ 130

  Fly   170 ARRIFRQVATAVYYCHKHKICHRDLKLENILLDEKGNAKIADFGLSNVFDD----QRLLGTFCGS 230
            ::..|.|::.|:.|.|...|.|||||.|||||.::.|.|:||||.:....|    :....|:|||
  Fly   131 SKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGS 195

  Fly   231 PLYASPEIVEGTPYQGPEVDCWSLGVLLYTLVYGSMPFDGSNFKRLVKQISQGDYYEPRKPSRAS 295
            ..||:||:|.|.||.....|.|||||:|:.::...||||.||..:|::......:...||...  
  Fly   196 AAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKFAFRRKLQE-- 258

  Fly   296 TLIRDMLTVCPRKRASIEQIC-----SHWWVNENDNVSCLDLAEDLANQTPV 342
                   |:..:.:|::..:.     :.|.:.|..|.:.|...|:  :|||:
  Fly   259 -------TISAQAKATVSVLLEPEAHARWNLREILNCAWLRTVEE--SQTPI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 86/267 (32%)
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 86/274 (31%)
S_TKc 28..287 CDD:214567 85/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.