DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nuak1 and Tssk6

DIOPT Version :9

Sequence 1:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster
Sequence 2:NP_001099548.1 Gene:Tssk6 / 290670 RGDID:1559764 Length:273 Species:Rattus norvegicus


Alignment Length:263 Identity:97/263 - (36%)
Similarity:147/263 - (55%) Gaps:16/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEAEADLVR--IRREVQIMSSVHHPNIIHIYEV 136
            :.:|:|:|.||::..:|:....||||.:.:.:  |..|.|.  :.||:.|:..|.||:|:|::|.
  Rat    16 RTIGEGSYSKVKVATSKKYKGTVAIKVVDRRR--APPDFVNKFLPRELSILRGVRHPHIVHVFEF 78

  Fly   137 FE-NREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICHRDLKLENIL 200
            .| ...|:.:||| ||..:|...:.....:...:||.:|.|:|.||.|.|.|.:.|||||.||:|
  Rat    79 IEVCNGKLYIVME-AAATDLLQAVQRNGRIPGSQARELFSQIAGAVRYLHDHHLVHRDLKCENVL 142

  Fly   201 L--DEKGNAKIADFGL---SNVFDDQRLLGTFCGSPLYASPEIVEGTPYQGPEVDCWSLGVLLYT 260
            |  ||: ..|:.|||.   ::.:.|  |..|:|||..|||||::.|.||...:.|.|||||:||.
  Rat   143 LSPDER-RVKLTDFGFGRQAHGYPD--LSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYV 204

  Fly   261 LVYGSMPFDGSNFKRLVKQISQGDYYEP--RKPSRASTLIRDMLTVCPRKRASIEQICSHWWVNE 323
            :|.|.||||.|:...|.::..:|..|..  ....|..:||.::|...|..|.|..|:..:.|:..
  Rat   205 MVTGCMPFDDSDIAGLPRRQKRGVLYPDGLELSERCKSLIAELLQFSPSARPSAGQVARNGWLRA 269

  Fly   324 NDN 326
            .|:
  Rat   270 GDS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 95/256 (37%)
Tssk6NP_001099548.1 STKc_TSSK6-like 11..267 CDD:271066 95/256 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.