DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nuak1 and tag-344

DIOPT Version :9

Sequence 1:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster
Sequence 2:NP_492786.1 Gene:tag-344 / 182017 WormBaseID:WBGene00015230 Length:367 Species:Caenorhabditis elegans


Alignment Length:263 Identity:87/263 - (33%)
Similarity:140/263 - (53%) Gaps:7/263 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KKLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEAEADLVR--IRREVQIMSSVH 126
            |..:.:|:  |.||.|:|.:|......|...|||.|.|.......:.|.::  :.||.:|:..:.
 Worm    65 KVWKLKFE--KVLGSGSYSRVARATFGEKKLEVAAKIINITPTREKEDYIKKFLPREKEIVKLLK 127

  Fly   127 HPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICH 191
            |.||..:||:...::.::.|.|:.|||:|...:.:...:.||:|:..|||:..|:.:...:.|.|
 Worm   128 HDNICRLYEMISFQDHIIFVNEYCAGGDLLRKMKDIVAMKEEDAKFTFRQLIAALTHLQSYNIVH 192

  Fly   192 RDLKLENILLDEKGNAKIADFGLSNVFDDQRLLGTFCGSPLYASPEIVEGTPYQGPEVDCWSLGV 256
            ||||.|||.:|:.||.|:.|||.|.:.......||||||..|.:|||..|..|.|..||.||.||
 Worm   193 RDLKCENIFMDKHGNVKLGDFGFSRILKPGEKSGTFCGSRAYVAPEIFRGREYSGNAVDVWSTGV 257

  Fly   257 LLYTLVYGSMPFDGSNFKRLVKQISQGDYYEPRKPSR---ASTLIRDMLTVCPRKRASIEQICSH 318
            :||.::.||||||..:.::::::........|:..:.   :..|:.::|......|.:.:.||..
 Worm   258 ILYIMLAGSMPFDDRDPRKMIERQLAHKIKFPKSCTSSVFSKALVLEILQPHAPNRPTYKAICES 322

  Fly   319 WWV 321
            .|:
 Worm   323 EWL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 85/257 (33%)
tag-344NP_492786.1 PKc_like 71..325 CDD:389743 85/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.