DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nuak1 and Y38H8A.4

DIOPT Version :9

Sequence 1:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster
Sequence 2:NP_502595.1 Gene:Y38H8A.4 / 178314 WormBaseID:WBGene00012638 Length:331 Species:Caenorhabditis elegans


Alignment Length:268 Identity:94/268 - (35%)
Similarity:142/268 - (52%) Gaps:12/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KKLRQRFDIIKKLGQGTYGKVQLGINKETGQEVAIKTIKKCKIEAEADLVR--IRREVQIMSSVH 126
            |:.:.:||  |.||.|:|.:|......:...|||.|.|.......:.|.::  :.||.:|:..:.
 Worm    32 KEHKLKFD--KILGSGSYSRVARATWGDKKLEVAAKVINITPTREKDDYIKKFLPREKEIVKLLK 94

  Fly   127 HPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICH 191
            |.|:..:||:....:.::.|.||.|||:|...:.:.|.::||.|:..|||...|:.:...:.|.|
 Worm    95 HDNVCRLYEMISFPDHIIFVTEFCAGGDLLRKMKKIKTMSEENAKFTFRQFIAALMHLQSYNIVH 159

  Fly   192 RDLKLENILLDEKGNAKIADFGLSNVFDDQRLLGTFCGSPLYASPEIVEGTPYQGPEVDCWSLGV 256
            ||||.|||.||:..|.|:.|||.|.:.......||||||..|.:|||:.|..|.|..||.||.||
 Worm   160 RDLKCENIFLDKYENVKLGDFGFSRILKPGEKSGTFCGSRAYVAPEILRGREYSGNAVDVWSTGV 224

  Fly   257 LLYTLVYGSMPFDGSNFKRLVK-----QISQGDYYEPRKPSRASTLIRDMLTVCPRKRASIEQIC 316
            :||.::.|:||||..:..|:::     :|..|........|:|  ||.::|......|.:.:.||
 Worm   225 ILYIMLVGTMPFDDRDPTRMIERQLAHKIKFGKTCTASIHSKA--LILEILQPHAPNRPTYKAIC 287

  Fly   317 -SHWWVNE 323
             |.|..|:
 Worm   288 ESEWLKNQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 92/260 (35%)
Y38H8A.4NP_502595.1 PKc_like 38..292 CDD:389743 91/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.