DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and HST2

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_015310.1 Gene:HST2 / 856092 SGDID:S000005936 Length:357 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:75/267 - (28%)
Similarity:113/267 - (42%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VVLHTGAGISTSAGIPDFRGP-KGVW----TLEEKGEKPDFNVSFDEA----------------- 89
            |:...|||||||.||||||.| .|::    .|:....:..|:|.|.::                 
Yeast    27 VIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNF 91

  Fly    90 RPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQCKKCRRQFVSPSAV 154
            ||:|.|..:....:...::.|.:||||.|..::|:....:.|.||:.....|..|.:  |.|..|
Yeast    92 RPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGK--VYPPQV 154

  Fly   155 ETVGQKSLQRACKS--SMDSKGRSCRSGILYDNVLDWEHDLPE-------NDLEMGVMHSTVA-- 208
              ...|..:...|.  ..|..|...:..|::     :..|||:       ||.|......|.:  
Yeast   155 --FKSKLAEHPIKDFVKCDVCGELVKPAIVF-----FGEDLPDSFSETWLNDSEWLREKITTSGK 212

  Fly   209 ----DLNIALGTTLQIVPSGDLPLKNLKCGGKFVICNLQPTKHDKKAN-----LIISSYVDVVLS 264
                .|.|.:||:|.:.|...|| :.:....|.|:|||: |..|.|||     ||:..|.|....
Yeast   213 HPQQPLVIVVGTSLAVYPFASLP-EEIPRKVKRVLCNLE-TVGDFKANKRPTDLIVHQYSDEFAE 275

  Fly   265 KVCKLLG 271
            ::.:.||
Yeast   276 QLVEELG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 71/252 (28%)
HST2NP_015310.1 SIRT1 26..277 CDD:238699 73/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54280
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.