DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and HST4

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_010477.3 Gene:HST4 / 851772 SGDID:S000002599 Length:370 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:76/320 - (23%)
Similarity:130/320 - (40%) Gaps:89/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FDSDEVV----AEKCQE---------LAELIKKSGHVVLHTGAGISTSAGIPDFRGPKGVWTLEE 75
            ||.|..|    ..|.|.         ::..:..|..:|:.:|||||.:|||||||..:|:::...
Yeast    59 FDLDAYVDSTHLSKSQRHHMDRDAGFISYALNYSKRMVVVSGAGISVAAGIPDFRSSEGIFSTVN 123

  Fly    76 KGEKPD------------FNVSFDE-----------ARPTKTHMAIIALIESGYVQYVISQNIDG 117
            .|...|            .::.|::           .:|||.|..:......|.:..:.:|||||
Yeast   124 GGSGKDLFDYNRVYGDESMSLKFNQLMVSLFRLSKNCQPTKFHEMLNEFARDGRLLRLYTQNIDG 188

  Fly   118 L-----HLKSG--LDRKYLS--ELHGNIYIEQCKKC------------------RRQFVSPSAVE 155
            |     ||.:.  |.:...|  :|||:|...:|.||                  .|..:.||..:
Yeast   189 LDTQLPHLSTNVPLAKPIPSTVQLHGSIKHMECNKCLNIKPFDPELFKCDDKFDSRTEIIPSCPQ 253

  Fly   156 TVGQKSLQRACKSSMDSKGRSCRSGILYDNVL---DWEHDLPENDLEMGVMHSTVADLNIALGTT 217
            ....:::::.........|:.....|||:.|.   |:..::..|||:..:      |..|.:||:
Yeast   254 CEEYETVRKMAGLRSTGVGKLRPRVILYNEVHPEGDFIGEIANNDLKKRI------DCLIIVGTS 312

  Fly   218 LQIVPSGDLPLKNLKC--------GGKFVICNLQPTKHDKKANLIIS-SYVDVVLSKVCK 268
            |:| |.    :||: |        ..:.::..|..:...|  |::.| .:||:|:...|:
Yeast   313 LKI-PG----VKNI-CRQFAAKVHANRGIVLYLNTSMPPK--NVLDSLKFVDLVVLGDCQ 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 65/274 (24%)
HST4NP_010477.3 SIR2 77..370 CDD:223915 70/302 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.