DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and SRT1

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_200387.1 Gene:SRT1 / 835670 AraportID:AT5G55760 Length:473 Species:Arabidopsis thaliana


Alignment Length:328 Identity:140/328 - (42%)
Similarity:202/328 - (61%) Gaps:25/328 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCNYADGLSAYDNKGILGAPESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFR 65
            ||..||:.||..::.|.:|..|.||...::..|.:|||:||:||.|:|:.||||||||.||||||
plant     1 MSLGYAEKLSFIEDVGQVGMAEFFDPSHLLQCKIEELAKLIQKSKHLVVFTGAGISTSCGIPDFR 65

  Fly    66 GPKGVWTLEEKG-EKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYL 129
            ||||:|||:.:| :.|..::.|..|.|:.||||::.|..:|.:::|||||:|||||:||:.|:.|
plant    66 GPKGIWTLQREGKDLPKASLPFHRAMPSMTHMALVELERAGILKFVISQNVDGLHLRSGIPREKL 130

  Fly   130 SELHGNIYIEQCKKCRRQFVSPSAVETVGQKSLQRACKSSMDSKGRSCRSGILYDNVLDWEHDLP 194
            |||||:.::|.|..|..:::....|||:|.|...|.|  |::..|..     |.|.|||||..||
plant   131 SELHGDSFMEMCPSCGAEYLRDFEVETIGLKETSRKC--SVEKCGAK-----LKDTVLDWEDALP 188

  Fly   195 ENDLEMGVMHSTVADLNIALGTTLQIVPSGDLPLKNLKCGGKFVICNLQPTKHDKKANLIISSYV 259
            ..:::....|...|||.:.|||:|||.|:.:||||.||.|||.||.|||.|..|||||::|...|
plant   189 PKEIDPAEKHCKKADLVLCLGTSLQITPACNLPLKCLKGGGKIVIVNLQKTPKDKKANVVIHGLV 253

  Fly   260 DVVLSKVCKLLGVEIPEY------------SEASDPTKQSKPMEWTIPTSNVNTFHRQYKKYVKD 312
            |.|::.|.:.|.::||.|            |.:.|    .:.:.||:..::|:....|. .::|.
plant   254 DKVVAGVMESLNMKIPPYVRIDLFQIILTQSISGD----QRFINWTLRVASVHGLTSQL-PFIKS 313

  Fly   313 SKI 315
            .::
plant   314 IEV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 106/213 (50%)
SRT1NP_200387.1 SIRT7 45..252 CDD:238701 106/213 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1943
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6924
Inparanoid 1 1.050 252 1.000 Inparanoid score I1025
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503290at2759
OrthoFinder 1 1.000 - - FOG0006144
OrthoInspector 1 1.000 - - oto3903
orthoMCL 1 0.900 - - OOG6_104149
Panther 1 1.100 - - LDO PTHR48252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4436
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.