DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and Sirt6

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001365873.1 Gene:Sirt6 / 50721 MGIID:1354161 Length:334 Species:Mus musculus


Alignment Length:329 Identity:152/329 - (46%)
Similarity:209/329 - (63%) Gaps:7/329 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCNYADGLSAYDNKGILGAPESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFR 65
            ||.|||.|||.|.:||..|.||.||..|.:..|..|||.|:.:|..||.||||||||::||||||
Mouse     1 MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLMWQSSSVVFHTGAGISTASGIPDFR 65

  Fly    66 GPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLS 130
            ||.||||:||:|..|.|:.:|:.|||:|||||::.|...|::.:::|||:||||::||..|..|:
Mouse    66 GPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLA 130

  Fly   131 ELHGNIYIEQCKKCRRQFVSPSAVETVGQKSLQRACKSSMDSKGRSCRSGILYDNVLDWEHDLPE 195
            |||||:::|:|.||:.|:|..:.|.|:|.|:..|.|..:.....|:|| |.|.|.:||||..||:
Mouse   131 ELHGNMFVEECPKCKTQYVRDTVVGTMGLKATGRLCTVAKTRGLRACR-GELRDTILDWEDSLPD 194

  Fly   196 NDLEMGVMHSTVADLNIALGTTLQIVPSGDLPLKNLKCGGKFVICNLQPTKHDKKANLIISSYVD 260
            .||.:....|..|||::.|||:|||.|||:|||...:.||:.||.||||||||::|:|.|..|||
Mouse   195 RDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLRIHGYVD 259

  Fly   261 VVLSKVCKLLGVEIPEY------SEASDPTKQSKPMEWTIPTSNVNTFHRQYKKYVKDSKIESKA 319
            .|:.::.|.||:|||.:      .:|..|..:...::...|.......|..||.......:....
Mouse   260 EVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPP 324

  Fly   320 KKTK 323
            |:.|
Mouse   325 KRVK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 111/212 (52%)
Sirt6NP_001365873.1 SIRT7 45..257 CDD:238701 111/211 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..334 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836235
Domainoid 1 1.000 138 1.000 Domainoid score I4845
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6924
Inparanoid 1 1.050 294 1.000 Inparanoid score I2738
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54280
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006144
OrthoInspector 1 1.000 - - oto93214
orthoMCL 1 0.900 - - OOG6_104149
Panther 1 1.100 - - LDO PTHR48252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4758
SonicParanoid 1 1.000 - - X4436
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.