DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and Sirt7

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster


Alignment Length:287 Identity:98/287 - (34%)
Similarity:147/287 - (51%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGPKGVWTLEEKGEKPDFNV-S 85
            |..|:..|:..|.::||.:|.::.|:|.:|||||||:|.|||:||.:|:|||.:||:  |... .
  Fly   101 EREDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQ--DIGEHD 163

  Fly    86 FDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQCKKCR----- 145
            ...|.||.||||:..|.....:.:|:|||.|||||:|||.|..|||:|||:|:|.||.||     
  Fly   164 LSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVY 228

  Fly   146 -RQFVSPSAVETVGQKSLQRACKSSMDSKGRSCRSGILYDNV------------LDWEHDLPEND 197
             |||.:.........|: .|.|        ..| |..|||.:            |:|..      
  Fly   229 WRQFDTTEMTARYCHKT-HRLC--------HRC-SEPLYDTIVHFGERGNVKWPLNWAG------ 277

  Fly   198 LEMGVMHSTVADLNIALGTTLQIVP------SGDLPLKNLKCGGKFVICNLQPTKHDKKANLIIS 256
               ...::..||:.:.||::|:::.      ..|.|.:.   ..|..:.|||.|..|..|::.|:
  Fly   278 ---ATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQ---RAKICVVNLQWTPKDAIASIKIN 336

  Fly   257 SYVDVVLSKVCKLLGVEIPEYSEASDP 283
            ...|.|::::..||.:.:|.|::..||
  Fly   337 GKCDQVMAQLMHLLHIPVPVYTKEKDP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 83/237 (35%)
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 83/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438946
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503290at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.