DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and Sirt2

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster


Alignment Length:220 Identity:60/220 - (27%)
Similarity:92/220 - (41%) Gaps:68/220 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VVLHTGAGISTSAGIPDFRGP-KGVWTLEEKGEKPD----FNVSFDEAR---------------- 90
            :|...||||||||||||||.| .|:::..:|.|.|.    |::.:.|..                
  Fly    81 IVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYPGSF 145

  Fly    91 -PTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQCKKCRRQFVSPSAV 154
             ||..|..|..|.:.|.:|...:||||.|...:||....:.|.||:.:...|.|||:::      
  Fly   146 IPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEY------ 204

  Fly   155 ETVGQKSLQRACKSSMD-----------SKGRSCRSGILYDNVLDWEHDL-------PENDLEMG 201
                          .||           .|.:.|: |::..:::.:..:|       ||.|.:  
  Fly   205 --------------DMDWMKAEIFADRLPKCQKCQ-GVVKPDIVFFGENLPKRFYSSPEEDFQ-- 252

  Fly   202 VMHSTVADLNIALGTTLQIVPSGDL 226
                 ..||.|.:||:|::.|...|
  Fly   253 -----DCDLLIIMGTSLEVQPFASL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 60/220 (27%)
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 60/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.