DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and sirt6

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001002071.1 Gene:sirt6 / 415161 ZFINID:ZDB-GENE-031007-2 Length:354 Species:Danio rerio


Alignment Length:330 Identity:163/330 - (49%)
Similarity:221/330 - (66%) Gaps:22/330 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCNYADGLSAYDNKGILGAPESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFR 65
            ||.|||.|||.|.:|||.|.||:|||.|.:..|.:.||:.|::|.::|:|:|||||||.||||||
Zfish     1 MSVNYAAGLSPYADKGICGLPETFDSPEELKTKVETLAQWIRESQYMVVHSGAGISTSTGIPDFR 65

  Fly    66 GPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLS 130
            ||.||||:||:||.|.||.:|::|||:.||||::.:..:|:::|:||||:||||::||..|..||
Zfish    66 GPNGVWTMEERGETPHFNTTFEDARPSLTHMALLQMQRTGHLKYLISQNVDGLHVRSGFPRDRLS 130

  Fly   131 ELHGNIYIEQCKKCRRQFVSPSAVETVGQKSLQRACKSSMDSKG-RSCRSGILYDNVLDWEHDLP 194
            |||||:::|:|:||.:|:|..:.|..:|.|...|.| ..|.|:| |||| |.|..::||||..||
Zfish   131 ELHGNMFVEECEKCGKQYVRDTVVGVMGLKPTGRYC-DVMRSRGLRSCR-GKLISSILDWEDSLP 193

  Fly   195 ENDLEMGVMHSTVADLNIALGTTLQIVPSGDLPLKNLKCGGKFVICNLQPTKHDKKANLIISSYV 259
            :.||......|..|||.:.|||:|||.|||||||...:.|||.||.|||||||||.|:|.|..||
Zfish   194 DRDLNRADEASRRADLALTLGTSLQIKPSGDLPLLTKRTGGKLVIVNLQPTKHDKHAHLRIYGYV 258

  Fly   260 DVVLSKVCKLLGVEIPEYSEASDPTKQSKPMEWTIPT----SNVNTFHRQYKKYVKDSKIESKAK 320
            |.|:.::.||||:::|               ||..||    |..:.....|..:.|:.|||.|.:
Zfish   259 DDVMGQLMKLLGLDVP---------------EWAGPTLCEDSGGDLDILPYGAWKKEVKIELKIE 308

  Fly   321 KTKYT 325
            ::.:|
Zfish   309 ESNHT 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 118/213 (55%)
sirt6NP_001002071.1 SIRT7 46..257 CDD:238701 118/212 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579697
Domainoid 1 1.000 133 1.000 Domainoid score I5037
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6924
Inparanoid 1 1.050 305 1.000 Inparanoid score I2620
OMA 1 1.010 - - QHG54280
OrthoDB 1 1.010 - - D1503290at2759
OrthoFinder 1 1.000 - - FOG0006144
OrthoInspector 1 1.000 - - oto39045
orthoMCL 1 0.900 - - OOG6_104149
Panther 1 1.100 - - LDO PTHR48252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4758
SonicParanoid 1 1.000 - - X4436
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.