DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and sirt6

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_989353.1 Gene:sirt6 / 394980 XenbaseID:XB-GENE-5929105 Length:331 Species:Xenopus tropicalis


Alignment Length:313 Identity:155/313 - (49%)
Similarity:208/313 - (66%) Gaps:13/313 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCNYADGLSAYDNKGILGAPESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFR 65
            ||.|||.|||.|.:||..|.||:||..:.:..|..|||::|:||.:||.|||||||||.||||||
 Frog     1 MSVNYAAGLSPYSDKGRCGLPEAFDPPDELCRKVVELADMIRKSSYVVFHTGAGISTSCGIPDFR 65

  Fly    66 GPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLS 130
            ||.|||||||||..|.|:::|:.|.|:.||||::.|...|.:::::|||:||||::||..|:.|:
 Frog    66 GPNGVWTLEEKGVNPKFDITFESACPSPTHMALLQLQRVGILKFLVSQNVDGLHVRSGFPREQLA 130

  Fly   131 ELHGNIYIEQCKKCRRQFVSPSAVETVGQKSLQRACKSSMDSKGRSCRSGILYDNVLDWEHDLPE 195
            |||||:::|:|.||.:|:|....|.|:|.|...|.|........|:|| |.|.|.:||||..||:
 Frog   131 ELHGNMFVEECSKCSKQYVRDQVVGTMGLKPTGRLCDVPKVRGLRACR-GKLKDTILDWEDSLPD 194

  Fly   196 NDLEMGVMHSTVADLNIALGTTLQIVPSGDLPLKNLKCGGKFVICNLQPTKHDKKANLIISSYVD 260
            .||.:.......|||:|.|||:|||.|||:|||...:.|||.||.|||||||||.|:|.|..|||
 Frog   195 RDLNLADEACRKADLSITLGTSLQIRPSGNLPLLTKRKGGKLVIVNLQPTKHDKHADLRIHGYVD 259

  Fly   261 VVLSKVCKLLGVEIPEYSEASDPTKQSKPMEWTIPTSNVNTFHRQYKKYVKDS 313
            .|::::.:|||.:||.::  ..|||       |.||   |..:::...:..||
 Frog   260 EVMTQLMELLGHKIPVWT--GMPTK-------TEPT---NGNYKEENHFYNDS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 114/212 (54%)
sirt6NP_989353.1 SIRT7 45..257 CDD:238701 114/212 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5283
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6924
Inparanoid 1 1.050 295 1.000 Inparanoid score I2695
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503290at2759
OrthoFinder 1 1.000 - - FOG0006144
OrthoInspector 1 1.000 - - oto103467
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4758
SonicParanoid 1 1.000 - - X4436
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.