DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and Sirt2

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_006228734.1 Gene:Sirt2 / 361532 RGDID:621481 Length:489 Species:Rattus norvegicus


Alignment Length:391 Identity:88/391 - (22%)
Similarity:128/391 - (32%) Gaps:154/391 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGPK-GVWTLEEKGEKP----DFNVSF---- 86
            :|:|:          .|:...||||||||||||||.|. |::...||...|    .|.:|:    
  Rat   102 SERCR----------RVICLVGAGISTSAGIPDFRSPSTGLYANLEKYHLPYPEAIFEISYFKKH 156

  Fly    87 -------------DEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYI 138
                         .:.:||..|..|..|.|.|.:....:||||.|...:||:.:.|.|.||..|.
  Rat   157 PEPFFALAKELYPGQFKPTICHYFIRLLKEKGLLLRCYTQNIDTLERVAGLEPQDLVEAHGTFYT 221

  Fly   139 E--------------------------QCKKCRRQFVSPSAVET------------------VGQ 159
            .                          :|:|| :..|.|...:|                  :..
  Rat   222 SHCVNTSCGKEYTMSWMKEKIFSEATPKCEKC-QNVVKPGEPQTPFFHWPARTSNLATLLPGLSP 285

  Fly   160 KSLQR-------------------ACKSSMD--SKGRSCRSGILYDNVLDWEHDLPENDLEMGVM 203
            ..|||                   ||.||:.  |...|....:...:::.:..:||.........
  Rat   286 TVLQRVGICLPFPPHPCPSWAPTPACFSSVPHVSSPLSLCLSVSTSDIVFFGENLPPRFFSCMQS 350

  Fly   204 HSTVADLNIALGTTLQIVPSGDL----PLKNLKCGGKFVICNLQPTKH----------------- 247
            ..:..||.|.:||:||:.|...|    ||...:     ::.|.:.|..                 
  Rat   351 DFSKVDLLIIMGTSLQVQPFASLISKAPLATPR-----LLINKEKTGQTDPFLGMMMGLGGGMDF 410

  Fly   248 -DKKANLIISSYVDVVLSKVC--------KLLG---------------VEIPEYSEASDPTKQSK 288
             .|||      |.||.....|        .|||               ::....|:||:|:....
  Rat   411 DSKKA------YRDVAWLGDCDQGCLALADLLGWKKELEDLVRREHANIDAQSGSQASNPSATVS 469

  Fly   289 P 289
            |
  Rat   470 P 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 74/321 (23%)
Sirt2XP_006228734.1 SIRT1 106..432 CDD:238699 78/347 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54280
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.