DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and Sirt1

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster


Alignment Length:296 Identity:71/296 - (23%)
Similarity:125/296 - (42%) Gaps:57/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NKGILGAPESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGPKGVWT--LEEK 76
            ||  |.:..:||          ::..|:|||..:::.||||:|.|.||||||...|::.  ..:.
  Fly   203 NK--LASVNTFD----------DVISLVKKSQKIIVLTGAGVSVSCGIPDFRSTNGIYARLAHDF 255

  Fly    77 GEKPDFNVSFD---------------------EARPTKTHMAIIALIESGYVQYVISQNIDGLHL 120
            .:.||....||                     |.:|:..|..|..|...|.:....:||||.|..
  Fly   256 PDLPDPQAMFDINYFKRDPRPFYKFAREIYPGEFQPSPCHRFIKMLETKGKLLRNYTQNIDTLER 320

  Fly   121 KSGLDRKYLSELHGNIYIEQCKKCR---------------RQFVSPSAVETVGQKSLQRACKSSM 170
            .:|:.|  :.|.||:.....|.|||               |..|.|.. :...::|:..:...:.
  Fly   321 VAGIQR--VIECHGSFSTASCTKCRFKCNADALRADIFAQRIPVCPQC-QPNKEQSVDASVAVTE 382

  Fly   171 DSKGRSCRSGILYDNVLDWEHDLPENDLEMGVMHSTVADLNIALGTTLQIVPSGDLPLKNLKCGG 235
            :...:...:||:..:::.:...||:....:......|.||.|.:|::|::.|...:| .::....
  Fly   383 EELRQLVENGIMKPDIVFFGEGLPDEYHTVMATDKDVCDLLIVIGSSLKVRPVAHIP-SSIPATV 446

  Fly   236 KFVICNLQPTKHDK-KANLIISSYVDVVLSKVCKLL 270
            ..::.|.:...|.| ...|:..|  ||:::::|..|
  Fly   447 PQILINREQLHHLKFDVELLGDS--DVIINQICHRL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 57/251 (23%)
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 9/36 (25%)
SIRT1 222..476 CDD:238699 60/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438950
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.