DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and Sirt7

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_008766699.1 Gene:Sirt7 / 303745 RGDID:1305876 Length:426 Species:Rattus norvegicus


Alignment Length:307 Identity:107/307 - (34%)
Similarity:149/307 - (48%) Gaps:65/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGPKGVWTLEEKGEKPDFNVSF 86
            |..|..|.:..|.:|||..::.:.|:|::|||||||:|.|||:|||.|||||.:|| :|......
  Rat    78 EVCDDPEELRRKVRELAGAVRSARHLVVYTGAGISTAASIPDYRGPNGVWTLLQKG-RPVSAADL 141

  Fly    87 DEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQCKKCRRQFVSP 151
            .||.||.|||:|..|.:...||:|:|||.|||||:|||.|..:||||||:|||.....|.|.:..
  Rat   142 SEAEPTLTHMSITQLHKHKLVQHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVSSAQRTQGLGD 206

  Fly   152 SAVE-TVGQKSLQRACKSSMDSK-------------------GRSC-RSGI-LYDNV-------- 186
            ..:. ||  .||.:.|.|.:.::                   ||:| :.|. |.|.:        
  Rat   207 KQMSLTV--PSLPQVCTSCIPNREYVRVFDVTERTALHRHLTGRTCHKCGTQLRDTIVHFGERGT 269

  Fly   187 ----LDWEHDLPENDLEMGVMHSTVADLNIALGTTLQIV-----------PSGDLPLKNLKCGGK 236
                |:|         |.....::.||..:.||::|:::           |....|        |
  Rat   270 LGQPLNW---------EAATEAASKADTILCLGSSLKVLKKYPRLWCMTKPPSRRP--------K 317

  Fly   237 FVICNLQPTKHDKKANLIISSYVDVVLSKVCKLLGVEIPEYSEASDP 283
            ..|.|||.|..|..|.|.:....|.|:..:...||:|||.|:...||
  Rat   318 LYIVNLQWTPKDDWAALKLHGKCDDVMRLLMDELGLEIPVYNRWQDP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 90/257 (35%)
Sirt7XP_008766699.1 SIRT7 102..339 CDD:238701 90/256 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D468902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.