DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and Sirt3

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_006230588.1 Gene:Sirt3 / 293615 RGDID:1308374 Length:334 Species:Rattus norvegicus


Alignment Length:275 Identity:76/275 - (27%)
Similarity:115/275 - (41%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QELAELI--KKSGHVVLHTGAGISTSAGIPDFRGP-KGVWT------------LEEKG-----EK 79
            |::|||:  :....||:..||||||.:||||||.| .|:::            :.|.|     .|
  Rat    61 QDVAELLRTRACSRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPK 125

  Fly    80 PDFNVSFD----EARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQ 140
            |.|.::.:    ..||...|..:..|.:...:..:.:||||||...||:....|.|.||:.....
  Rat   126 PFFTLAKELYPGHYRPNVAHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGSFVSAT 190

  Fly   141 CKKCRRQFVSPSAVETVGQKSLQR--ACKSSMDSKGRSCRSGILYDNVLDWEHDLPENDLEMGVM 203
            |..|||.|........|....:.|  .|            :|::..:::.:...||...| :.|.
  Rat   191 CTVCRRSFPGEDIRADVMADRVPRCPVC------------TGVVKPDIVFFGEQLPARFL-LHVA 242

  Fly   204 HSTVADLNIALGTTLQIVPSGDLP----------LKNLKCGGKFVICNLQPTKHDKKANLIISSY 258
            ...:|||.:.|||:|::.|...|.          |.|....|.|.   |.|.:.|      :...
  Rat   243 DFALADLLLILGTSLEVEPFASLSESVQKSVPRLLINRDLVGSFA---LSPRRKD------VVQL 298

  Fly   259 VDVV--LSKVCKLLG 271
            .|||  :.::..|||
  Rat   299 GDVVQGVERLVDLLG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 66/246 (27%)
Sirt3XP_006230588.1 SIRT1 74..308 CDD:238699 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54280
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.