DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt6 and SIRT4

DIOPT Version :9

Sequence 1:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001372662.1 Gene:SIRT4 / 23409 HGNCID:14932 Length:314 Species:Homo sapiens


Alignment Length:284 Identity:72/284 - (25%)
Similarity:121/284 - (42%) Gaps:81/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGPK-GVWTLEEKGEKP----DFNVS------ 85
            ||.:||...|..|..:::.|||||||.:||||:|..| |::...::  :|    ||..|      
Human    42 EKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDR--RPIQHGDFVRSAPIRQR 104

  Fly    86 -----------FDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIE 139
                       |...:|...|.|:....:.|.:.::::||:|.||.|:|..|  |:||||.:...
Human   105 YWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRR--LTELHGCMDRV 167

  Fly   140 QCKKC-----------RRQFVSPS-AVETVG----------QKSLQRACKSSMDSKGRSCRSGIL 182
            .|..|           |.|.::|: :.|..|          ::.::.....:....|...:..::
Human   168 LCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVV 232

  Fly   183 Y--DNVLDWEHDLPENDLEMGVMHSTV--ADLNIALGTTLQIVPSG----------DLPLKNLKC 233
            :  |.|         |..::..:|..|  ||..:.:|::||:. ||          .||:     
Human   233 FFGDTV---------NPDKVDFVHKRVKEADSLLVVGSSLQVY-SGYRFILTAWEKKLPI----- 282

  Fly   234 GGKFVICNLQPTKHDKKANLIISS 257
                .|.|:.||:.|..|.|.::|
Human   283 ----AILNIGPTRSDDLACLKLNS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 66/271 (24%)
SIRT4NP_001372662.1 SIRT4 47..308 CDD:238700 69/279 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.