DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42795 and Tbc1d22b

DIOPT Version :10

Sequence 1:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster
Sequence 2:NP_001401270.1 Gene:Tbc1d22b / 381085 MGIID:2681867 Length:514 Species:Mus musculus


Alignment Length:237 Identity:56/237 - (23%)
Similarity:88/237 - (37%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 GTPPEFRRKLWLSLADKYL----KSKNVDWAQQREKC--FCEEW-----REDDEELGIQIVKDLH 274
            |.|.|.|...| .|...||    :.:.:...::||:.  |.|::     .|..::...||..|:.
Mouse   219 GVPREVRPVTW-RLLSGYLPANTERRKLTLQRKREEYFGFIEQYYDSRNEEHHQDTYRQIHIDIP 282

  Fly   275 RTGSNLCTGPAGSINQAKL-----KRILLGYARYNPEVGYCQGFNMLGALILQVMDKE------- 327
            |      |.|...:.|..|     :|||..:|..:|..||.||.|.|......|...|       
Mouse   283 R------TNPLIPLFQQPLVQEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFLSEYVEEDVE 341

  Fly   328 ---------------EEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHL 377
                           |.:|...|..|::|:.....|  :..|:|..:....||:.....::..|.
Mouse   342 NFDVTNLSQDMLRSIEADSFWCMSKLLDGIQDNYTF--AQPGIQKKVKALEELVSRIDEQVHSHF 404

  Fly   378 QRLQGPVENAFEPPLTNVFTMQWFLTMFCTCLPMSCVLRVWD 419
            :|.:  ||..       .|..:|...:....||:.|.:|:||
Mouse   405 RRYE--VEYL-------QFAFRWMNNLLMRELPLRCTIRLWD 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:459855 43/179 (24%)
DUF4682 560..689 CDD:464830
PTZ00121 <1112..2009 CDD:173412
PTZ00121 <1740..2340 CDD:173412
PTZ00449 <2270..2610 CDD:185628
Tbc1d22bNP_001401270.1 TBC 216..466 CDD:214540 56/237 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.