DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12817 and cgref1

DIOPT Version :9

Sequence 1:NP_001036701.1 Gene:CG12817 / 41250 FlyBaseID:FBgn0037798 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_017207316.1 Gene:cgref1 / 559576 ZFINID:ZDB-GENE-131121-137 Length:259 Species:Danio rerio


Alignment Length:167 Identity:40/167 - (23%)
Similarity:67/167 - (40%) Gaps:27/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSNLLNFI-------ICIASFSQNFDATLAVK-RGPHHPRGETRRVDQHLTHEEHRIDDDLKDMG 63
            :|..|.|:       :|........|..||.. ..|.....:.||:.|..      |..:||:..
Zfish    24 ISTRLVFVLILPALTLCAPQVQSLSDGVLAPDLANPFGSSEDNRRLLQSY------IKSNLKEGQ 82

  Fly    64 VQANLDDLSEEEKIFYMFKAHDNDNNNALDGLEMIQSAMHHNYDYFKNNERDAYLQNATDELEHF 128
            ....|:  :.|:::|::|..:|.|.:..:||||::|...    |:.      .|.:.|....:..
Zfish    83 TSPELN--TREQEVFFLFSLYDYDRSGQMDGLELMQLLT----DFL------TYHEMAPKSTDSV 135

  Fly   129 IEAIDKFLLIADDNNDGLLHYPEFVKAITGGKEQPNV 165
            :..:|..|...|.|.||||...|.:...| .:.|.|:
Zfish   136 VTLVDYLLQTQDLNQDGLLAPSELLSPST-MEHQDNI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12817NP_001036701.1 EF-hand_7 77..156 CDD:290234 21/78 (27%)
cgref1XP_017207316.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.