DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12817 and mcfd2

DIOPT Version :9

Sequence 1:NP_001036701.1 Gene:CG12817 / 41250 FlyBaseID:FBgn0037798 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_031757527.1 Gene:mcfd2 / 496472 XenbaseID:XB-GENE-981596 Length:157 Species:Xenopus tropicalis


Alignment Length:165 Identity:46/165 - (27%)
Similarity:70/165 - (42%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MCN---LSNLL-------NFIICIASFSQNFDATLAVKR-GPHHPRG-ETRRVDQHLTHEEHRID 56
            |||   ||.:.       :.:.|:...:..|.:.:|... .||...| ...|..:.:..::..|.
 Frog     1 MCNNRSLSTMAAQRASTSSLLCCLVVSALLFMSAVAEDHVHPHVEEGNHGARFGKSVVQDKDHIM 65

  Fly    57 DDLKDMGVQANLDDLSEEEKIFYMFKAHDNDNNNALDGLEMIQSAMHHNYDYFKNNERDAYLQNA 121
            |.| |..::....::|.:|...:.||.||.|.||.|||||:..:..|    ..|:.|........
 Frog    66 DHL-DGVIEKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELATAISH----VHKSTEEPTQAMKE 125

  Fly   122 TDELEHFIEAIDKFLLIADDNNDGLLHYPEFVKAI 156
            .|    .|..||..|...|.||||.:.|.||.:::
 Frog   126 ED----LISLIDDVLRDDDKNNDGYIDYAEFARSL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12817NP_001036701.1 EF-hand_7 77..156 CDD:290234 28/78 (36%)
mcfd2XP_031757527.1 EFh 89..154 CDD:238008 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5269
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1601131at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.