DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12817 and mcfd2

DIOPT Version :9

Sequence 1:NP_001036701.1 Gene:CG12817 / 41250 FlyBaseID:FBgn0037798 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001005939.1 Gene:mcfd2 / 449676 ZFINID:ZDB-GENE-041010-8 Length:154 Species:Danio rerio


Alignment Length:114 Identity:35/114 - (30%)
Similarity:55/114 - (48%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVDQHLTHEEHRIDDDLKDMGVQANLDDLSEEEKIFYMFKAHDNDNNNALDGLEMIQSAMHHNYD 107
            |:|:::..:...|.:.|:.: |:....:::.:|...:.||.||.|.||.|||||:..:..|    
Zfish    48 RLDRNMVQDREHIMEHLEGI-VEKQESEMTPQELQLHYFKMHDYDGNNLLDGLELATAITH---- 107

  Fly   108 YFKNNERDAYLQNATDELEHFIEAIDKFLLIADDNNDGLLHYPEFVKAI 156
             ....||....|...:  |..|..||..|...|.||||.:.|.||..::
Zfish   108 -VHREERGGDSQPMRE--EDLINLIDDVLRDDDKNNDGYIDYAEFATSL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12817NP_001036701.1 EF-hand_7 77..156 CDD:290234 29/78 (37%)
mcfd2NP_001005939.1 EF-hand_7 85..151 CDD:290234 29/72 (40%)
EFh 85..150 CDD:298682 28/71 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5446
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1601131at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.