DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12817 and CG17271

DIOPT Version :9

Sequence 1:NP_001036701.1 Gene:CG12817 / 41250 FlyBaseID:FBgn0037798 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_650916.1 Gene:CG17271 / 42463 FlyBaseID:FBgn0038829 Length:281 Species:Drosophila melanogaster


Alignment Length:130 Identity:44/130 - (33%)
Similarity:64/130 - (49%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GPHHPRGE----TRRVDQHLTH-EEHRIDDDLKDMGVQANLDDLSEEEKIFYMFKAHDNDNNNAL 92
            |.||.:.:    |..:.|...| :||        |.|..:...:||.|..|:.||.||:||||.|
  Fly   129 GHHHGQPQQVLNTGNIQQERAHIQEH--------MQVPIDTSKMSEAELQFHYFKMHDSDNNNKL 185

  Fly    93 DGLEMIQSAMHHNYDYFKN--NERDAYLQNATDELEHFIEAIDKFLLIADDNNDGLLHYPEFVKA 155
            ||.|:|:|.:|.:....|.  |....:::......|..:..||..|.:.|.:.||.:.||||:||
  Fly   186 DGCELIKSLIHWHEQGSKEQPNGEKPHVEEKVFSDEELVALIDPILQMDDTSRDGYIDYPEFIKA 250

  Fly   156  155
              Fly   251  250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12817NP_001036701.1 EF-hand_7 77..156 CDD:290234 31/81 (38%)
CG17271NP_650916.1 EF-hand_7 174..250 CDD:290234 28/75 (37%)
EFh 174..250 CDD:298682 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449716
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4065
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4004
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124098at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23104
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.