DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12817 and C29E4.14

DIOPT Version :9

Sequence 1:NP_001036701.1 Gene:CG12817 / 41250 FlyBaseID:FBgn0037798 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001033352.1 Gene:C29E4.14 / 3896749 WormBaseID:WBGene00044634 Length:124 Species:Caenorhabditis elegans


Alignment Length:106 Identity:29/106 - (27%)
Similarity:48/106 - (45%) Gaps:19/106 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DDD-----LKD-MGVQANLD-DLSEEEKIFYMFKAHDNDNNNALDGLEMIQSAMHHNYDYFKNNE 113
            |||     ||| .|.:..:: ..|.:::.||.||..|.:.:|.|||:|:.:....|:.:..|.  
 Worm    28 DDDLSIEHLKDHYGNKIEIEKHTSSKDRKFYYFKVGDTNQDNHLDGVELFKMITEHSDEKTKM-- 90

  Fly   114 RDAYLQNATDELEHFIEAIDKFLLIADDNNDGLLHYPEFVK 154
                      ::|......|..|...|.|.||::.:.|:.|
 Worm    91 ----------DVEMIEVQADLVLSELDKNGDGMISFSEYSK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12817NP_001036701.1 EF-hand_7 77..156 CDD:290234 21/78 (27%)
C29E4.14NP_001033352.1 EF-hand_7 60..119 CDD:290234 17/70 (24%)
EFh 60..118 CDD:298682 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.